PDB entry 1wcd

View 1wcd on RCSB PDB site
Description: crystal structure of ibdv t1 virus-like particle reveals a missing link in icosahedral viruses evolution
Class: virus
Keywords: virus, non-enveloped icosahedral viruses, double-stranded RNA virus protein, birnavirus, transcriptase machinery, hydrolase, membrane translocation activity, evolution, icosahedral virus
Deposited on 2004-11-12, released 2005-04-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.219
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'J':
    Compound: major structural protein vp2
    Species: INFECTIOUS BURSAL DISEASE VIRUS [TaxId:10995]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wcdj1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1wcdJ (J:)
    mtnlqdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevadlnsplkiaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wcdJ (J:)
    ivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsivga
    hytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyalngtinavtfq
    gslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigld
    pkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrt
    svhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsikl
    eivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsn
    felipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmeva
    d