PDB entry 1wca

View 1wca on RCSB PDB site
Description: molecular recognition of an ADP-ribosylating clostridium botulinum c3 exoenzyme by rala gtpase
Class: transferase
Keywords: exoenzyme, gtpase, ADP, ribosylating toxin, transferase
Deposited on 2004-11-11, released 2005-03-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2005-04-15, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.66 Å
R-factor: 0.206
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Ral-A
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1wcaa_
  • Chain 'B':
    Compound: Mono-ADP-ribosyltransferase C3
    Species: Clostridium botulinum
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wcaA (A:)
    maankpkgqnslalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldge
    evqidildtagqedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenv
    pfllvgnksdledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkm
    edskekngkkkrkslakrirerccil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wcaA (A:)
    slalhkvimvgsggvgksaltlqfmydefvedyeptkadsyrkkvvldgeevqidildta
    gqedyaairdnyfrsgegflcvfsitemesfaatadfreqilrvkedenvpfllvgnksd
    ledkrqvsveeaknraeqwnvnyvetsaktranvdkvffdlmreirarkmedsk
    

  • Chain 'B':
    No sequence available.