PDB entry 1wc9

View 1wc9 on RCSB PDB site
Description: the crystal structure of truncated mouse bet3p
Class: transport protein
Keywords: vesicle transport, tethering factor, trapp, transport protein, golgi stack, endoplasmic reticulum
Deposited on 2004-11-10, released 2004-12-13
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.2066
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trafficking protein particle complex subunit3
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1wc9a_
  • Heterogens: MYR, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wc9A (A:)
    gteskkmsselftltygalvtqlckdyendedvnkqldrmgynigvrliedflarsnvgr
    chdfretadviakvafkmylgitpsitnwspagdefslilennplvdfvelpdnhsaliy
    snllcgvlrgalemvqmaveakfvqdtlkgdgvteirmrfirrie
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wc9A (A:)
    kkmsselftltygalvtqlckdyendedvnkqldrmgynigvrliedflarsnvgrchdf
    retadviakvafkmylgitpsitnwspagdefslilennplvdfvelpdnhsaliysnll
    cgvlrgalemvqmaveakfvqdtlkgdgvteirmrfirrie