PDB entry 1wc6

View 1wc6 on RCSB PDB site
Description: Soluble adenylyl cyclase CyaC from S. platensis in complex with Rp- ATPalphaS in presence of bicarbonate
Class: lyase
Keywords: cyclase, soluble adenylyl cyclase, camp signaling, lyase
Deposited on 2004-11-08, released 2004-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.241
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylate cyclase
    Species: SPIRULINA PLATENSIS [TaxId:118562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wc6a_
  • Chain 'B':
    Compound: adenylate cyclase
    Species: SPIRULINA PLATENSIS [TaxId:118562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wc6b_
  • Chain 'C':
    Compound: adenylate cyclase
    Species: SPIRULINA PLATENSIS [TaxId:118562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wc6c_
  • Heterogens: TAT, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wc6A (A:)
    mgsshhhhhhssglvprgshmgdltldlrpeprlitilfsdivgftrmsnalqsqgvael
    lneylgemtravfenqgtvdkfvgdaimalygapeemspseqvrraiatarqmlvalekl
    nqgwqerglvgrnevppvrfrcgihqgmavvglfgsqersdftaigpsvniaarlqeata
    pnsimvsamvaqyvpdeeiikreflelkgidepvmtcvinpnmlnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wc6A (A:)
    lrpeprlitilfsdivgftrmsnalqsqgvaellneylgemtravfenqgtvdkfvgdai
    malygapeemspseqvrraiatarqmlvaleklnqgwqerglvgvppvrfrcgihqgmav
    vglfgsqersdftaigpsvniaarlqeatapnsimvsamvaqyvpdeeiikreflelkgi
    depvmtcvinpnml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wc6B (B:)
    mgsshhhhhhssglvprgshmgdltldlrpeprlitilfsdivgftrmsnalqsqgvael
    lneylgemtravfenqgtvdkfvgdaimalygapeemspseqvrraiatarqmlvalekl
    nqgwqerglvgrnevppvrfrcgihqgmavvglfgsqersdftaigpsvniaarlqeata
    pnsimvsamvaqyvpdeeiikreflelkgidepvmtcvinpnmlnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wc6B (B:)
    lrpeprlitilfsdivgftrmsnalqsqgvaellneylgemtravfenqgtvdkfvgdai
    malygapeemspseqvrraiatarqmlvaleklnqgwqerglvgvppvrfrcgihqgmav
    vglfgsqersdftaigpsvniaarlqeatapnsimvsamvaqyvpdeeiikreflelkgi
    depvmtcvinpnm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wc6C (C:)
    mgsshhhhhhssglvprgshmgdltldlrpeprlitilfsdivgftrmsnalqsqgvael
    lneylgemtravfenqgtvdkfvgdaimalygapeemspseqvrraiatarqmlvalekl
    nqgwqerglvgrnevppvrfrcgihqgmavvglfgsqersdftaigpsvniaarlqeata
    pnsimvsamvaqyvpdeeiikreflelkgidepvmtcvinpnmlnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wc6C (C:)
    lrpeprlitilfsdivgftrmsnalqsqgvaellneylgemtravfenqgtvdkfvgdai
    malygapeemspseqvrraiatarqmlvaleklnqgwqerglvgvppvrfrcgihqgmav
    vglfgsqersdftaigpsvniaarlqeatapnsimvsamvaqyvpdeeiikreflelkgi
    depvmtcvinpnml