PDB entry 1wc4

View 1wc4 on RCSB PDB site
Description: soluble adenylyl cyclase cyac from s. platensis in complex with alpha,beta-methylene-ATP and europium
Class: lyase
Keywords: cyclase, soluble adenylyl cyclase, camp signaling, lyase
Deposited on 2004-11-08, released 2004-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.274
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylate cyclase
    Species: SPIRULINA PLATENSIS [TaxId:118562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WC4 (Start-20)
    • Uniprot O32393 (21-End)
    Domains in SCOPe 2.07: d1wc4a1, d1wc4a2
  • Chain 'B':
    Compound: adenylate cyclase
    Species: SPIRULINA PLATENSIS [TaxId:118562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WC4 (Start-20)
    • Uniprot O32393 (21-End)
    Domains in SCOPe 2.07: d1wc4b1, d1wc4b2
  • Heterogens: APC, EU3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wc4A (A:)
    mgsshhhhhhssglvprgshmrpeprlitilfsdivgftrmsnalqsqgvaellneylge
    mtravfenqgtvdkfvgdaimalygapeemspseqvrraiatarqmlvaleklnqgwqer
    glvgrnevppvrfrcgihqgmavvglfgsqersdftaigpsvniaarlqeatapnsimvs
    amvaqyvpdeeiikreflelkgidepvmtcvinpnmlnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wc4A (A:)
    shmrpeprlitilfsdivgftrmsnalqsqgvaellneylgemtravfenqgtvdkfvgd
    aimalygapeemspseqvrraiatarqmlvaleklnqgwqerglvgrnevppvrfrcgih
    qgmavvglfgsqersdftaigpsvniaarlqeatapnsimvsamvaqyvpdeeiikrefl
    elkgidepvmtcvinpnmln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wc4B (B:)
    mgsshhhhhhssglvprgshmrpeprlitilfsdivgftrmsnalqsqgvaellneylge
    mtravfenqgtvdkfvgdaimalygapeemspseqvrraiatarqmlvaleklnqgwqer
    glvgrnevppvrfrcgihqgmavvglfgsqersdftaigpsvniaarlqeatapnsimvs
    amvaqyvpdeeiikreflelkgidepvmtcvinpnmlnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wc4B (B:)
    mrpeprlitilfsdivgftrmsnalqsqgvaellneylgemtravfenqgtvdkfvgdai
    malygapeemspseqvrraiatarqmlvaleklnqgwqerglvgrvppvrfrcgihqgma
    vvglfgsqersdftaigpsvniaarlqeatapnsimvsamvaqyvpdeeiikreflelkg
    idepvmtcvinpnmln