PDB entry 1wc2

View 1wc2 on RCSB PDB site
Description: beta-1,4-d-endoglucanase cel45a from blue mussel mytilus edulis at 1.2a
Class: hydrolase
Keywords: hydrolase, cellulase, cellulose, double-psi fold, glycoside hydrolase
Deposited on 2004-11-08, released 2006-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.147
AEROSPACI score: 0.83 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase
    Species: MYTILUS EDULIS [TaxId:6550]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wc2a1
  • Heterogens: ACT, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wc2A (A:)
    nqkcsgnprryngkscasttnyhdshkgacgcgpasgdaqfgwnagsfvaaasqmyfdsg
    nkgwcgqhcgqcikltttggyvpgqggpvreglsktfmitnlcpniypnqdwcnqgsqyg
    ghnkygyelhldlengrsqvtgmgwnnpettwevvncdsehnhdhrtpsnsmygqcqcah
    q
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wc2A (A:)
    nqkcsgnprryngkscasttnyhdshkgacgcgpasgdaqfgwnagsfvaaasqmyfdsg
    nkgwcgqhcgqcikltttggyvpgqggpvreglsktfmitnlcpniypnqdwcnqgsqyg
    ghnkygyelhldlengrsqvtgmgwnnpettwevvncdsehnhdhrtpsnsmygqcqcah