PDB entry 1wbz

View 1wbz on RCSB PDB site
Description: crystal structures of murine MHC class I h-2 db and kb molecules in complex with ctl epitopes from influenza a virus: implications for tcr repertoire selection and immunodominance
Class: immune system
Keywords: MHC class I, influenza peptide, ha468, immune system
Deposited on 2004-11-05, released 2005-01-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: h-2 class I histocompatibility antigen, k-b alpha chain precursor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wbza1, d1wbza2
  • Chain 'B':
    Compound: beta-2microglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wbzb_
  • Chain 'C':
    Compound: h-2 class I histocompatibility antigen, k-b alpha chain precursor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wbzc1, d1wbzc2
  • Chain 'D':
    Compound: beta-2microglobulin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wbzd_
  • Chain 'P':
    Compound: influenza a peptide
    Species: Influenza A virus, synthetic [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WBZ (0-8)
  • Chain 'Q':
    Compound: influenza a peptide
    Species: Influenza A virus, synthetic [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WBZ (0-8)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wbzA (A:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrwe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wbzB (B:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wbzC (C:)
    gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
    eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
    cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
    rtdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgt
    fqkwasvvvplgkeqyytchvyhqglpepltlrwe
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wbzD (D:)
    iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
    sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.