PDB entry 1wbp

View 1wbp on RCSB PDB site
Description: srpk1 bound to 9mer docking motif peptide
Deposited on 2004-11-04, released 2005-10-19
The last revision was dated 2017-02-08, with a file datestamp of 2017-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase sprk1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACT, ADP

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1wbpA (A:)
    peqeeeilgsdddeqedpndyckggyhlvkigdlfngryhvirklgwghfstvwlswdiq
    gkkfvamkvvksaehytetaldeirllksvrnsdpndpnremvvqllddfkisgvngthi
    cmvfevlghhllkwiiksnyqglplpcvkkiiqqvlqgldylhtkcriihtdikpenill
    svneqyirrlaaeatewqrsgapppsgsavstapatagnflvnplepknaeklkvkiadl
    gnacwvhkhftediqtrqyrslevligsgyntpadiwstacmafelatgdylfephsgee
    ytrdedhialiiellgkvprklivagkyskefftkkgdlkhitklkpwglfevlvekyew
    sqeeaagftdfllpmlelipekrataaeclrhpwlns
    

    Sequence, based on observed residues (ATOM records):
    >1wbpA (A:)
    yhlvkigdlfngryhvirklgwghfstvwlswdiqgkkfvamkvvksaehytetaldeir
    llksvrnsdpndpnremvvqllddfkisgvngthicmvfevlghhllkwiiksnyqglpl
    pcvkkiiqqvlqgldylhtkcriihtdikpenillsvneqyirrlaaeatenflvnplep
    knaeklkvkiadlgnacwvhkhftediqtrqyrslevligsgyntpadiwstacmafela
    tgdylfephsgeeytrdedhialiiellgkvprklivagkyskefftkkgdlkhitklkp
    wglfevlvekyewsqeeaagftdfllpmlelipekrataaeclrhpwlns
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1wbpB (B:)
    rrrersptr
    

    Sequence, based on observed residues (ATOM records):
    >1wbpB (B:)
    rersptr