PDB entry 1wbi

View 1wbi on RCSB PDB site
Description: avr2
Class: avidin-related protein
Keywords: avidin-related protein, avidin related protein, biotin
Deposited on 2004-11-01, released 2005-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.175
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: avidin-related protein 2
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WBI
    • Uniprot P56732 (3-End)
    Domains in SCOPe 2.07: d1wbia_
  • Chain 'B':
    Compound: avidin-related protein 2
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wbib_
  • Chain 'C':
    Compound: avidin-related protein 2
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WBI
    • Uniprot P56732 (3-End)
    Domains in SCOPe 2.07: d1wbic_
  • Chain 'D':
    Compound: avidin-related protein 2
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WBI
    • Uniprot P56732 (3-End)
    Domains in SCOPe 2.07: d1wbid_
  • Chain 'E':
    Compound: avidin-related protein 2
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WBI
    • Uniprot P56732 (3-End)
    Domains in SCOPe 2.07: d1wbie_
  • Chain 'F':
    Compound: avidin-related protein 2
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WBI
    • Uniprot P56732 (3-End)
    Domains in SCOPe 2.07: d1wbif_
  • Chain 'G':
    Compound: avidin-related protein 2
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wbig_
  • Chain 'H':
    Compound: avidin-related protein 2
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wbih_
  • Heterogens: BTN, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wbiA (A:)
    qtvarkcsltgewdndlgsimtigavndngefdgtyitavadnpgnitlspllgiqhkra
    sqptfgftvhwnfsestsvfvgqcfvdrsgkevlktkwlqrlavddisddwiatrvgnnd
    ftrqhtvee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wbiA (A:)
    arkcsltgewdndlgsimtigavndngefdgtyitavadnpgnitlspllgiqhkrasqp
    tfgftvhwnfsestsvfvgqcfvdrsgkevlktkwlqrlavddisddwiatrvgnndftr
    qht
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wbiB (B:)
    qtvarkcsltgewdndlgsimtigavndngefdgtyitavadnpgnitlspllgiqhkra
    sqptfgftvhwnfsestsvfvgqcfvdrsgkevlktkwlqrlavddisddwiatrvgnnd
    ftrqhtvee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wbiB (B:)
    rkcsltgewdndlgsimtigavndngefdgtyitavadnpgnitlspllgiqhkrasqpt
    fgftvhwnfsestsvfvgqcfvdrsgkevlktkwlqrlavddisddwiatrvgnndftrq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wbiC (C:)
    qtvarkcsltgewdndlgsimtigavndngefdgtyitavadnpgnitlspllgiqhkra
    sqptfgftvhwnfsestsvfvgqcfvdrsgkevlktkwlqrlavddisddwiatrvgnnd
    ftrqhtvee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wbiC (C:)
    arkcsltgewdndlgsimtigavndngefdgtyitavadnpgnitlspllgiqhkrasqp
    tfgftvhwnfsestsvfvgqcfvdrsgkevlktkwlqrlavddisddwiatrvgnndftr
    q
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wbiD (D:)
    qtvarkcsltgewdndlgsimtigavndngefdgtyitavadnpgnitlspllgiqhkra
    sqptfgftvhwnfsestsvfvgqcfvdrsgkevlktkwlqrlavddisddwiatrvgnnd
    ftrqhtvee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wbiD (D:)
    arkcsltgewdndlgsimtigavndngefdgtyitavadnpgnitlspllgiqhkrasqp
    tfgftvhwnfsestsvfvgqcfvdrsgkevlktkwlqrlavddisddwiatrvgnndftr
    q
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1wbiE (E:)
    qtvarkcsltgewdndlgsimtigavndngefdgtyitavadnpgnitlspllgiqhkra
    sqptfgftvhwnfsestsvfvgqcfvdrsgkevlktkwlqrlavddisddwiatrvgnnd
    ftrqhtvee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wbiE (E:)
    arkcsltgewdndlgsimtigavndngefdgtyitavadnpgnitlspllgiqhkrasqp
    tfgftvhwnfsestsvfvgqcfvdrsgkevlktkwlqrlavddisddwiatrvgnndftr
    q
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1wbiF (F:)
    qtvarkcsltgewdndlgsimtigavndngefdgtyitavadnpgnitlspllgiqhkra
    sqptfgftvhwnfsestsvfvgqcfvdrsgkevlktkwlqrlavddisddwiatrvgnnd
    ftrqhtvee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wbiF (F:)
    arkcsltgewdndlgsimtigavndngefdgtyitavadnpgnitlspllgiqhkrasqp
    tfgftvhwnfsestsvfvgqcfvdrsgkevlktkwlqrlavddisddwiatrvgnndftr
    qht
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1wbiG (G:)
    qtvarkcsltgewdndlgsimtigavndngefdgtyitavadnpgnitlspllgiqhkra
    sqptfgftvhwnfsestsvfvgqcfvdrsgkevlktkwlqrlavddisddwiatrvgnnd
    ftrqhtvee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wbiG (G:)
    rkcsltgewdndlgsimtigavndngefdgtyitavadnpgnitlspllgiqhkrasqpt
    fgftvhwnfsestsvfvgqcfvdrsgkevlktkwlqrlavddisddwiatrvgnndftrq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1wbiH (H:)
    qtvarkcsltgewdndlgsimtigavndngefdgtyitavadnpgnitlspllgiqhkra
    sqptfgftvhwnfsestsvfvgqcfvdrsgkevlktkwlqrlavddisddwiatrvgnnd
    ftrqhtvee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wbiH (H:)
    rkcsltgewdndlgsimtigavndngefdgtyitavadnpgnitlspllgiqhkrasqpt
    fgftvhwnfsestsvfvgqcfvdrsgkevlktkwlqrlavddisddwiatrvgnndftrq
    h