PDB entry 1wbh

View 1wbh on RCSB PDB site
Description: crystal structure of the e45n mutant from kdpg aldolase from escherichia coli
Class: lyase
Keywords: lyase, aldolase, kdpg aldolase, escherichia coli
Deposited on 2004-11-01, released 2006-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.17
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: khg/kdpg aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WBH
      • engineered mutation (45)
    • Uniprot P10177 (1-213)
    Domains in SCOPe 2.07: d1wbha1
  • Chain 'B':
    Compound: khg/kdpg aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WBH (0-0)
      • engineered mutation (45)
    • Uniprot P10177 (1-213)
    Domains in SCOPe 2.07: d1wbhb_
  • Chain 'C':
    Compound: khg/kdpg aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WBH
      • engineered mutation (45)
    • Uniprot P10177 (1-213)
    Domains in SCOPe 2.07: d1wbhc_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wbhA (A:)
    amknwktsaesilttgpvvpvivvkklehavpmakalvaggvrvlnvtlrtecavdaira
    iakevpeaivgagtvlnpqqlaevteagaqfaispgltepllkaategtiplipgistvs
    elmlgmdyglkefkffpaeanggvkalqaiagpfsqvrfcptggispanyrdylalksvl
    ciggswlvpadaleagdydritklareavegakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wbhA (A:)
    mknwktsaesilttgpvvpvivvkklehavpmakalvaggvrvlnvtlrtecavdairai
    akevpeaivgagtvlnpqqlaevteagaqfaispgltepllkaategtiplipgistvse
    lmlgmdyglkefkffpaeanggvkalqaiagpfsqvrfcptggispanyrdylalksvlc
    iggswlvpadaleagdydritklareavegakl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wbhB (B:)
    amknwktsaesilttgpvvpvivvkklehavpmakalvaggvrvlnvtlrtecavdaira
    iakevpeaivgagtvlnpqqlaevteagaqfaispgltepllkaategtiplipgistvs
    elmlgmdyglkefkffpaeanggvkalqaiagpfsqvrfcptggispanyrdylalksvl
    ciggswlvpadaleagdydritklareavegakl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wbhC (C:)
    amknwktsaesilttgpvvpvivvkklehavpmakalvaggvrvlnvtlrtecavdaira
    iakevpeaivgagtvlnpqqlaevteagaqfaispgltepllkaategtiplipgistvs
    elmlgmdyglkefkffpaeanggvkalqaiagpfsqvrfcptggispanyrdylalksvl
    ciggswlvpadaleagdydritklareavegakl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wbhC (C:)
    mknwktsaesilttgpvvpvivvkklehavpmakalvaggvrvlnvtlrtecavdairai
    akevpeaivgagtvlnpqqlaevteagaqfaispgltepllkaategtiplipgistvse
    lmlgmdyglkefkffpaeanggvkalqaiagpfsqvrfcptggispanyrdylalksvlc
    iggswlvpadaleagdydritklareavegakl