PDB entry 1wbg

View 1wbg on RCSB PDB site
Description: active site thrombin inhibitors
Deposited on 2004-11-01, released 2005-01-27
The last revision was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thrombin light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Thrombin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: hirugen
    Species: Hirudo medicinalis, synthetic [TaxId:6421]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: L03, DMS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1wbgA (A:)
    tfgsgeadcglrplfekksledkterellesyidgr
    

    Sequence, based on observed residues (ATOM records):
    >1wbgA (A:)
    geadcglrplfekksledkterellesyidgr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1wbgB (B:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstrir
    itdnmfcagykpdegkrgdacegdsggpfvmkspfnnrwyqmgivswgegcrddgkygfy
    thvfrlkkwiqkvidqfge
    

    Sequence, based on observed residues (ATOM records):
    >1wbgB (B:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhsrtryerniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlkegqpsvlqvvnlpiverpvckdstriritdnmfca
    gykpdegkrgdacegdsggpfvmkspfnnrwyqmgivswgegcrddgkygfythvfrlkk
    wiqkvidqfge
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >1wbgI (I:)
    dfeeipeeyl