PDB entry 1wbf

View 1wbf on RCSB PDB site
Description: winged bean lectin, saccharide free form
Deposited on 1998-12-16, released 1999-12-22
The last revision prior to the SCOP 1.67 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.197
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1wbfa_
  • Chain 'B':
    Domains in SCOP 1.67: d1wbfb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wbfA (A:)
    mktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwd
    sttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfv
    avefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvf
    pslgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpgtn
    ef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wbfA (A:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wbfB (B:)
    mktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwd
    sttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfv
    avefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvf
    pslgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpgtn
    ef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wbfB (B:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg