PDB entry 1wbe

View 1wbe on RCSB PDB site
Description: X-ray structure of bovine GLTP
Class: lipid transport
Keywords: glycolipid transfer protein, glycolipid transfer, acetylation, lipid transport
Deposited on 2004-11-01, released 2005-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycolipid transfer protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WBE
    • Uniprot P68265 (Start-208)
    Domains in SCOPe 2.07: d1wbea_
  • Heterogens: DKA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wbeA (A:)
    mallaehllrplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavy
    dtnptkfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenh
    pnlirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekv
    rlflvnytatidviyemytrmnaelnykv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wbeA (A:)
    ehllrplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtnpt
    kfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnlir
    vnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekvrlflv
    nytatidviyemytrmnaelnykv