PDB entry 1wbc

View 1wbc on RCSB PDB site
Description: crystallization and preliminary x-ray studies of psophocarpin b1, a chymotrypsin inhibitor from winged bean seeds
Class: serine protease inhibitor
Keywords: serine protease inhibitor
Deposited on 1995-11-30, released 1996-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chymotrypsin inhibitor (wci)
    Species: Psophocarpus tetragonolobus [TaxId:3891]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wbca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wbcA (A:)
    dddlvdaegnlvenggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiri
    ssqflslfiprgslvalgfanppscaaspwwtvvdspqgpavklsqqklpekdilvfkfe
    kvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkakseta
    ssh