PDB entry 1wb8

View 1wb8 on RCSB PDB site
Description: iron superoxide dismutase (fe-sod) from the hyperthermophile sulfolobus solfataricus. 2.3 a resolution structure of recombinant protein with a covalently modified tyrosin in the active site.
Class: oxidoreductase
Keywords: superoxide dismutase, sod, iron, oxidoreductase, superoxide radical disproportionation, sulfolobus solftaricus, thermostable
Deposited on 2004-10-31, released 2004-11-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.167
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase [fe]
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wb8a1, d1wb8a2
  • Chain 'B':
    Compound: superoxide dismutase [fe]
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wb8b1, d1wb8b2
  • Heterogens: FE, PMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wb8A (A:)
    tlqiqfkkyelpplpykidalepyiskdiidvhynghhkgyvngansllerlekvvkgdl
    qtgqydiqgiirgltfninghklhalywenmapsgkgggkpggaladlinkqygsfdrfk
    qvftetanslpgtgwavlyydtesgnlqimtfenhfqnhiaeipiilildefehayylqy
    knkradyvnawwnvvnwdaaekklqkyltk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wb8A (A:)
    iqfkkyelpplpykidalepyiskdiidvhynghhkgyvngansllerlekvvkgdlqtg
    qydiqgiirgltfninghklhalywenmapsgkgggkpggaladlinkqygsfdrfkqvf
    tetanslpgtgwavlyydtesgnlqimtfenhfqnhiaeipiilildefehayylqyknk
    radyvnawwnvvnwdaaekklqkyl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wb8B (B:)
    tlqiqfkkyelpplpykidalepyiskdiidvhynghhkgyvngansllerlekvvkgdl
    qtgqydiqgiirgltfninghklhalywenmapsgkgggkpggaladlinkqygsfdrfk
    qvftetanslpgtgwavlyydtesgnlqimtfenhfqnhiaeipiilildefehayylqy
    knkradyvnawwnvvnwdaaekklqkyltk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wb8B (B:)
    iqfkkyelpplpykidalepyiskdiidvhynghhkgyvngansllerlekvvkgdlqtg
    qydiqgiirgltfninghklhalywenmapsgkgggkpggaladlinkqygsfdrfkqvf
    tetanslpgtgwavlyydtesgnlqimtfenhfqnhiaeipiilildefehayylqyknk
    radyvnawwnvvnwdaaekklqkyl