PDB entry 1wb7

View 1wb7 on RCSB PDB site
Description: iron superoxide dismutase (fe-sod) from the hyperthermophile sulfolobus solfataricus. crystal structure of the y41f mutant.
Class: oxidoreductase
Keywords: superoxide dismutase, sod, iron, oxidoreductase, superoxide radical disproportionation, sulfolobus solftaricus, thermostable
Deposited on 2004-10-31, released 2004-11-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.24 Å
R-factor: 0.181
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase [fe]
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80857
      • engineered mutation (40)
    Domains in SCOPe 2.04: d1wb7a1, d1wb7a2
  • Chain 'B':
    Compound: superoxide dismutase [fe]
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80857
      • engineered mutation (40)
    Domains in SCOPe 2.04: d1wb7b1, d1wb7b2
  • Heterogens: FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wb7A (A:)
    tlqiqfkkyelpplpykidalepyiskdiidvhynghhkgfvngansllerlekvvkgdl
    qtgqydiqgiirgltfninghklhalywenmapsgkgggkpggaladlinkqygsfdrfk
    qvftetanslpgtgwavlyydtesgnlqimtfenhfqnhiaeipiilildefehayylqy
    knkradyvnawwnvvnwdaaekklqkyltk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wb7A (A:)
    iqfkkyelpplpykidalepyiskdiidvhynghhkgfvngansllerlekvvkgdlqtg
    qydiqgiirgltfninghklhalywenmapsgkgggkpggaladlinkqygsfdrfkqvf
    tetanslpgtgwavlyydtesgnlqimtfenhfqnhiaeipiilildefehayylqyknk
    radyvnawwnvvnwdaaekklqkyl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wb7B (B:)
    tlqiqfkkyelpplpykidalepyiskdiidvhynghhkgfvngansllerlekvvkgdl
    qtgqydiqgiirgltfninghklhalywenmapsgkgggkpggaladlinkqygsfdrfk
    qvftetanslpgtgwavlyydtesgnlqimtfenhfqnhiaeipiilildefehayylqy
    knkradyvnawwnvvnwdaaekklqkyltk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wb7B (B:)
    iqfkkyelpplpykidalepyiskdiidvhynghhkgfvngansllerlekvvkgdlqtg
    qydiqgiirgltfninghklhalywenmapsgkgggkpggaladlinkqygsfdrfkqvf
    tetanslpgtgwavlyydtesgnlqimtfenhfqnhiaeipiilildefehayylqyknk
    radyvnawwnvvnwdaaekklqkyl