PDB entry 1wb6

View 1wb6 on RCSB PDB site
Description: s954a mutant of the feruloyl esterase module from clostridium thermocellum complexed with vanillate
Class: hydrolase
Keywords: esterase family 1, ferulic acid, glycosidase, hydrolase, xylan degradation
Deposited on 2004-10-30, released 2006-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-02, with a file datestamp of 2011-01-28.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.118
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase y
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51584 (Start-288)
      • engineered mutation (165)
      • conflict (228-229)
      • expression tag (289-296)
    Domains in SCOPe 2.07: d1wb6a2, d1wb6a3
  • Chain 'B':
    Compound: endo-1,4-beta-xylanase y
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51584 (Start-288)
      • engineered mutation (165)
      • conflict (228-229)
      • expression tag (289-296)
    Domains in SCOPe 2.07: d1wb6b2, d1wb6b3
  • Heterogens: VXX, GOL, ACT, CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wb6A (A:)
    masdkfpvaenpsssfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylp
    ygydpnkkynifylmhgggenentifsndvklqnildhaimngeleplivvtptfnggnc
    taqnfyqefrqnvipfveskystyaesttpqgiaasrmhrgfggfamgglttwyvmvncl
    dyvayfmplsgdywygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqi
    eamkalphfdytsdfskgnfyflvapgathwwgyvrhyiydalpyffhelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wb6A (A:)
    sfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylpygydpnkkynifyl
    mhgggenentifsndvklqnildhaimngeleplivvtptfnggnctaqnfyqefrqnvi
    pfveskystyaesttpqgiaasrmhrgfggfamgglttwyvmvncldyvayfmplsgdyw
    ygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqieamkalphfdytsd
    fskgnfyflvapgathwwgyvrhyiydalpyffhelehhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wb6B (B:)
    masdkfpvaenpsssfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylp
    ygydpnkkynifylmhgggenentifsndvklqnildhaimngeleplivvtptfnggnc
    taqnfyqefrqnvipfveskystyaesttpqgiaasrmhrgfggfamgglttwyvmvncl
    dyvayfmplsgdywygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqi
    eamkalphfdytsdfskgnfyflvapgathwwgyvrhyiydalpyffhelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wb6B (B:)
    sfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylpygydpnkkynifyl
    mhgggenentifsndvklqnildhaimngeleplivvtptfnggnctaqnfyqefrqnvi
    pfveskystyaesttpqgiaasrmhrgfggfamgglttwyvmvncldyvayfmplsgdyw
    ygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqieamkalphfdytsd
    fskgnfyflvapgathwwgyvrhyiydalpyffhelehhhhhh