PDB entry 1wb5

View 1wb5 on RCSB PDB site
Description: s954a mutant of the feruloyl esterase module from clostridium thermocellum complexed with syringate
Class: hydrolase
Keywords: esterase family 1, ferulic acid, glycosidase, hydrolase, repeat, xylan degradation, xylanase
Deposited on 2004-10-30, released 2005-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.119
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endo-1,4-beta-xylanase y
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WB5 (289-296)
      • engineered mutation (165)
      • conflict see remark 9 (228-229)
    • Uniprot P51584 (Start-288)
    Domains in SCOPe 2.07: d1wb5a2, d1wb5a3
  • Chain 'B':
    Compound: endo-1,4-beta-xylanase y
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WB5 (289-296)
      • engineered mutation (165)
      • conflict see remark 9 (228-229)
    • Uniprot P51584 (Start-288)
    Domains in SCOPe 2.07: d1wb5b2, d1wb5b3
  • Heterogens: SYR, GOL, ACT, CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wb5A (A:)
    masdkfpvaenpsssfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylp
    ygydpnkkynifylmhgggenentifsndvklqnildhaimngeleplivvtptfnggnc
    taqnfyqefrqnvipfveskystyaesttpqgiaasrmhrgfggfamgglttwyvmvncl
    dyvayfmplsgdywygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqi
    eamkalphfdytsdfskgnfyflvapgathwwgyvrhyiydalpyffhelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wb5A (A:)
    sfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylpygydpnkkynifyl
    mhgggenentifsndvklqnildhaimngeleplivvtptfnggnctaqnfyqefrqnvi
    pfveskystyaesttpqgiaasrmhrgfggfamgglttwyvmvncldyvayfmplsgdyw
    ygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqieamkalphfdytsd
    fskgnfyflvapgathwwgyvrhyiydalpyffhelehhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wb5B (B:)
    masdkfpvaenpsssfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylp
    ygydpnkkynifylmhgggenentifsndvklqnildhaimngeleplivvtptfnggnc
    taqnfyqefrqnvipfveskystyaesttpqgiaasrmhrgfggfamgglttwyvmvncl
    dyvayfmplsgdywygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqi
    eamkalphfdytsdfskgnfyflvapgathwwgyvrhyiydalpyffhelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wb5B (B:)
    sfkyesavqyrpapdsylnpcpqagrivketytgingtkslnvylpygydpnkkynifyl
    mhgggenentifsndvklqnildhaimngeleplivvtptfnggnctaqnfyqefrqnvi
    pfveskystyaesttpqgiaasrmhrgfggfamgglttwyvmvncldyvayfmplsgdyw
    ygnspqdkansiaeainrsglskreyfvfaatgsediayanmnpqieamkalphfdytsd
    fskgnfyflvapgathwwgyvrhyiydalpyffhelehhhhhh