PDB entry 1wb1

View 1wb1 on RCSB PDB site
Description: Crystal structure of translation elongation factor SelB from Methanococcus maripaludis in complex with GDP
Class: protein synthesis
Keywords: selenocysteine, protein synthesis, selenium, ribosome
Deposited on 2004-10-29, released 2005-01-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-08-22, with a file datestamp of 2012-08-17.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.317
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: translation elongation factor selb
    Species: METHANOCOCCUS MARIPALUDIS [TaxId:39152]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WB1 (Start-13)
    • Uniprot Q8J307 (14-481)
    Domains in SCOPe 2.07: d1wb1a5, d1wb1a6, d1wb1a7, d1wb1a8, d1wb1a9
  • Chain 'B':
    Compound: translation elongation factor selb
    Species: METHANOCOCCUS MARIPALUDIS [TaxId:39152]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WB1
    • Uniprot Q8J307 (14-End)
    Domains in SCOPe 2.07: d1wb1b4, d1wb1b5, d1wb1b6
  • Chain 'C':
    Compound: translation elongation factor selb
    Species: METHANOCOCCUS MARIPALUDIS [TaxId:39152]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WB1 (Start-13)
    • Uniprot Q8J307 (14-481)
    Domains in SCOPe 2.07: d1wb1c5, d1wb1c6, d1wb1c7, d1wb1c8, d1wb1c9
  • Chain 'D':
    Compound: translation elongation factor selb
    Species: METHANOCOCCUS MARIPALUDIS [TaxId:39152]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wb1d4, d1wb1d5, d1wb1d6
  • Heterogens: GDP, MG, SO4, DXC

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wb1A (A:)
    mhhhhhhsiegrphmdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgit
    idigfsafklenyritlvdapghadliravvsaadiidlalivvdakegpktqtgehmli
    ldhfnipiivvitksdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelk
    nliittlnnaeiirntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinms
    tkvrsiqyfkesvmeakagdrvgmaiqgvdakqiyrgciltskdtklqtvdkivakikis
    difkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilnevisgnecycafelee
    kvlaevgdrvlitrldlppttlricghglieefkpikdlnikkevlregkvkidkgrtvi
    dglaqskvaaekligeeisiegkdivgkikgtfgtkglltaefsgnvenrdkvilnrlrr
    wg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wb1A (A:)
    phmdfkninlgifghidhgkttlskvlteiagfsafklenyritlvdapghadliravvs
    aadiidlalivvdakegpktqtgehmlildhfnipiivvitksdnagteeikrtemimks
    ilqsthnlknssiipisaktgfgvdelknliittlnnaeiirntesyfkmpldhafpikg
    agtvvtgtinkgivkvgdelkvlpinmstkvrsiqyfkesvmeakagdrvgmaiqgvdak
    qiyrgciltskdtklqtvdkivakikisdifkynltpkmkvhlnvgmlivpavavpfkkv
    tfgkteeniilnevisgnecycafeleekvlaevgdrvlitrldlppttlricghgliee
    fkpikdlnikkevlregkvkidkgrtvidglaqskvaaekligeeisiegkdivgkikgt
    fgtkglltaefsgnvenrdkvilnrlrrwg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wb1B (B:)
    mhhhhhhsiegrphmdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgit
    idigfsafklenyritlvdapghadliravvsaadiidlalivvdakegpktqtgehmli
    ldhfnipiivvitksdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelk
    nliittlnnaeiirntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinms
    tkvrsiqyfkesvmeakagdrvgmaiqgvdakqiyrgciltskdtklqtvdkivakikis
    difkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilnevisgnecycafelee
    kvlaevgdrvlitrldlppttlricghglieefkpikdlnikkevlregkvkidkgrtvi
    dglaqskvaaekligeeisiegkdivgkikgtfgtkglltaefsgnvenrdkvilnrlrr
    wg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wb1B (B:)
    mdfkninlgifghidhgkttlskvlteiaspesqkrgitidigfsafklenyritlvdap
    ghadliravvsaadiidlalivvdakegpktqtgehmlildhfnipiivvitksdnagte
    eikrtemimksilqsthnlknssiipisaktgfgvdelknliittlnnaeiirntesyfk
    mpldhafpikgagtvvtgtinkgivkvgdelkvlpinmstkvrsiqyfkesvmeakagdr
    vgmaiqgvdakqiyrgciltskdtklqtvdkivakikisdifkynltpkmkvhlnvgmli
    vpavavpfkkvtfgkteeniilnevisgnecycafeleekvlaevgdrvlitrldlpptt
    lricghglieefkpikdlnikk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wb1C (C:)
    mhhhhhhsiegrphmdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgit
    idigfsafklenyritlvdapghadliravvsaadiidlalivvdakegpktqtgehmli
    ldhfnipiivvitksdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelk
    nliittlnnaeiirntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinms
    tkvrsiqyfkesvmeakagdrvgmaiqgvdakqiyrgciltskdtklqtvdkivakikis
    difkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilnevisgnecycafelee
    kvlaevgdrvlitrldlppttlricghglieefkpikdlnikkevlregkvkidkgrtvi
    dglaqskvaaekligeeisiegkdivgkikgtfgtkglltaefsgnvenrdkvilnrlrr
    wg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wb1C (C:)
    egrphmdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgitidigfsafk
    lenyritlvdapghadliravvsaadiidlalivvdakegpktqtgehmlildhfnipii
    vvitksdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelknliittlnn
    aeiirntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinmstkvrsiqyf
    kesvmeakagdrvgmaiqgvdakqiyrgciltskdtklqtvdkivakikisdifkynltp
    kmkvhlnvgmlivpavavpfkkvtfgkteeniilnevisgnecycafeleekvlaevgdr
    vlitrldlppttlricghglieefkpikdlnikkevlregkvkidkgrtvidglaqskva
    aekligeeisiegkdivgkikgtfgtkglltaefsgnvenrdkvilnrlrrwg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wb1D (D:)
    mhhhhhhsiegrphmdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgit
    idigfsafklenyritlvdapghadliravvsaadiidlalivvdakegpktqtgehmli
    ldhfnipiivvitksdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelk
    nliittlnnaeiirntesyfkmpldhafpikgagtvvtgtinkgivkvgdelkvlpinms
    tkvrsiqyfkesvmeakagdrvgmaiqgvdakqiyrgciltskdtklqtvdkivakikis
    difkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilnevisgnecycafelee
    kvlaevgdrvlitrldlppttlricghglieefkpikdlnikkevlregkvkidkgrtvi
    dglaqskvaaekligeeisiegkdivgkikgtfgtkglltaefsgnvenrdkvilnrlrr
    wg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wb1D (D:)
    ninlgifghidhgkttlskvlteiastfsafklenyritlvddliravvsaadiidlali
    vvdakegpktqtgehmlildhfnipiivvitksdnagteeikrtemimksilqsthnlkn
    ssiipisaktgfgvdelknliittlnnaeiirntesyfkmpldhafpikgagtvvtgtin
    kgivkvgdelkvlpinmstkvrsiqyfkesvmeakagdrvgmaiqgvdakqiyrgcilts
    kdtklqtvdkivakikisdifkynltpkmkvhlnvgmlivpavavpfkkeniinecycaf
    eleekvlaevgdrvlitrldlppttlricghglieefkpikdlnik