PDB entry 1waz

View 1waz on RCSB PDB site
Description: nmr structure determination of the bacterial mercury transporter, merf, in micelles
Deposited on 2004-10-28, released 2005-04-11
The last revision was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MerF
    Species: Morganella morganii [TaxId:582]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1wazA (A:)
    tpvlvillgvvglsaltgyldyvllpalaifigltiyaiqrkrqad