PDB entry 1wav

View 1wav on RCSB PDB site
Description: crystal structure of form b monoclinic crystal of insulin
Class: hormone
Keywords: hormone, insulin, phenol
Deposited on 1996-02-28, released 1997-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.206
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-20)
  Domains in SCOPe 2.07: d1wav.1
• Chain 'B':
  Compound: insulin
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-29)
  Domains in SCOPe 2.07: d1wav.1
• Chain 'C':
  Compound: insulin
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-20)
  Domains in SCOPe 2.07: d1wav.2
• Chain 'D':
  Compound: insulin
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-29)
  Domains in SCOPe 2.07: d1wav.2
• Chain 'E':
  Compound: insulin
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-20)
  Domains in SCOPe 2.07: d1wav.3
• Chain 'F':
  Compound: insulin
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-29)
  Domains in SCOPe 2.07: d1wav.3
• Chain 'G':
  Compound: insulin
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-20)
  Domains in SCOPe 2.07: d1wav.4
• Chain 'H':
  Compound: insulin
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-29)
  Domains in SCOPe 2.07: d1wav.4
• Chain 'I':
  Compound: insulin
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-20)
  Domains in SCOPe 2.07: d1wav.5
• Chain 'J':
  Compound: insulin
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-29)
  Domains in SCOPe 2.07: d1wav.5
• Chain 'K':
  Compound: insulin
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-20)
  Domains in SCOPe 2.07: d1wav.6
• Chain 'L':
  Compound: insulin
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01315 (0-29)
  Domains in SCOPe 2.07: d1wav.6
• Heterogens: ZN, IPH, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wavA (A:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wavB (B:)
  fvnqhlcgshlvealylvcgergffytpka
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wavC (C:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wavD (D:)
  fvnqhlcgshlvealylvcgergffytpka
  

  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wavE (E:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wavF (F:)
  fvnqhlcgshlvealylvcgergffytpka
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wavG (G:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wavH (H:)
  fvnqhlcgshlvealylvcgergffytpka
  

  
  
• Chain 'I':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wavI (I:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'J':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wavJ (J:)
  fvnqhlcgshlvealylvcgergffytpka
  

  
  
• Chain 'K':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wavK (K:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wavL (L:)
  fvnqhlcgshlvealylvcgergffytpka