PDB entry 1wav
View 1wav on RCSB PDB site
Description: crystal structure of form b monoclinic crystal of insulin
Class: hormone
Keywords: hormone, insulin, phenol
Deposited on
1996-02-28, released
1997-02-28
The last revision prior to the SCOPe 2.01 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.206
AEROSPACI score: 0.27
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: insulin
Species: Sus scrofa [TaxId:9823]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d1wav.1 - Chain 'B':
Compound: insulin
Species: Sus scrofa [TaxId:9823]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d1wav.1 - Chain 'C':
Compound: insulin
Species: Sus scrofa [TaxId:9823]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d1wav.2 - Chain 'D':
Compound: insulin
Species: Sus scrofa [TaxId:9823]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d1wav.2 - Chain 'E':
Compound: insulin
Species: Sus scrofa [TaxId:9823]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d1wav.3 - Chain 'F':
Compound: insulin
Species: Sus scrofa [TaxId:9823]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d1wav.3 - Chain 'G':
Compound: insulin
Species: Sus scrofa [TaxId:9823]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d1wav.4 - Chain 'H':
Compound: insulin
Species: Sus scrofa [TaxId:9823]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d1wav.4 - Chain 'I':
Compound: insulin
Species: Sus scrofa [TaxId:9823]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d1wav.5 - Chain 'J':
Compound: insulin
Species: Sus scrofa [TaxId:9823]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d1wav.5 - Chain 'K':
Compound: insulin
Species: Sus scrofa [TaxId:9823]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d1wav.6 - Chain 'L':
Compound: insulin
Species: Sus scrofa [TaxId:9823]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d1wav.6 - Heterogens: ZN, IPH, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1wavA (A:)
giveqcctsicslyqlenycn
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1wavB (B:)
fvnqhlcgshlvealylvcgergffytpka
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1wavC (C:)
giveqcctsicslyqlenycn
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1wavD (D:)
fvnqhlcgshlvealylvcgergffytpka
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>1wavE (E:)
giveqcctsicslyqlenycn
- Chain 'F':
Sequence; same for both SEQRES and ATOM records: (download)
>1wavF (F:)
fvnqhlcgshlvealylvcgergffytpka
- Chain 'G':
Sequence; same for both SEQRES and ATOM records: (download)
>1wavG (G:)
giveqcctsicslyqlenycn
- Chain 'H':
Sequence; same for both SEQRES and ATOM records: (download)
>1wavH (H:)
fvnqhlcgshlvealylvcgergffytpka
- Chain 'I':
Sequence; same for both SEQRES and ATOM records: (download)
>1wavI (I:)
giveqcctsicslyqlenycn
- Chain 'J':
Sequence; same for both SEQRES and ATOM records: (download)
>1wavJ (J:)
fvnqhlcgshlvealylvcgergffytpka
- Chain 'K':
Sequence; same for both SEQRES and ATOM records: (download)
>1wavK (K:)
giveqcctsicslyqlenycn
- Chain 'L':
Sequence; same for both SEQRES and ATOM records: (download)
>1wavL (L:)
fvnqhlcgshlvealylvcgergffytpka