PDB entry 1wav

View 1wav on RCSB PDB site
Description: crystal structure of form b monoclinic crystal of insulin
Class: hormone
Keywords: hormone, insulin, phenol
Deposited on 1996-02-28, released 1997-02-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.206
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wav.1
  • Chain 'B':
    Compound: insulin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wav.1
  • Chain 'C':
    Compound: insulin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wav.2
  • Chain 'D':
    Compound: insulin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wav.2
  • Chain 'E':
    Compound: insulin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wav.3
  • Chain 'F':
    Compound: insulin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wav.3
  • Chain 'G':
    Compound: insulin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wav.4
  • Chain 'H':
    Compound: insulin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wav.4
  • Chain 'I':
    Compound: insulin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wav.5
  • Chain 'J':
    Compound: insulin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wav.5
  • Chain 'K':
    Compound: insulin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wav.6
  • Chain 'L':
    Compound: insulin
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wav.6
  • Heterogens: ZN, IPH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wavA (A:)
    giveqcctsicslyqlenycn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wavB (B:)
    fvnqhlcgshlvealylvcgergffytpka
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wavC (C:)
    giveqcctsicslyqlenycn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wavD (D:)
    fvnqhlcgshlvealylvcgergffytpka
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wavE (E:)
    giveqcctsicslyqlenycn
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wavF (F:)
    fvnqhlcgshlvealylvcgergffytpka
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wavG (G:)
    giveqcctsicslyqlenycn
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wavH (H:)
    fvnqhlcgshlvealylvcgergffytpka
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wavI (I:)
    giveqcctsicslyqlenycn
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wavJ (J:)
    fvnqhlcgshlvealylvcgergffytpka
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wavK (K:)
    giveqcctsicslyqlenycn
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wavL (L:)
    fvnqhlcgshlvealylvcgergffytpka