PDB entry 1wau

View 1wau on RCSB PDB site
Description: structure of kdpg aldolase e45n mutant
Class: lyase
Keywords: kdpg aldolase, escherichia coli, lyase, e45n mutant, multifunctional enzyme
Deposited on 2004-10-28, released 2006-01-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.174
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: khg/kdpg aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10177 (0-212)
      • engineered mutation (44)
    Domains in SCOPe 2.06: d1waua_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wauA (A:)
mknwktsaesilttgpvvpvivvkklehavpmakalvaggvrvlnvtlrtecavdairai
akevpeaivgagtvlnpqqlaevteagaqfaispgltepllkaategtiplipgistvse
lmlgmdyglkefkffpaeanggvkalqaiagpfsqvrfcptggispanyrdylalksvlc
iggswlvpadaleagdydritklareavegakl