PDB entry 1wau

View 1wau on RCSB PDB site
Description: Structure of KDPG Aldolase E45N mutant
Class: lyase
Keywords: kdpg aldolase, escherichia coli, lyase, e45n mutant, multifunctional enzyme
Deposited on 2004-10-28, released 2006-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: khg/kdpg aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10177 (0-212)
      • engineered mutation (44)
    Domains in SCOPe 2.07: d1waua_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wauA (A:)
    mknwktsaesilttgpvvpvivvkklehavpmakalvaggvrvlnvtlrtecavdairai
    akevpeaivgagtvlnpqqlaevteagaqfaispgltepllkaategtiplipgistvse
    lmlgmdyglkefkffpaeanggvkalqaiagpfsqvrfcptggispanyrdylalksvlc
    iggswlvpadaleagdydritklareavegakl