PDB entry 1was

View 1was on RCSB PDB site
Description: the three-dimensional structure of the ligand-binding domain of a wild-type bacterial chemotaxis receptor
Deposited on 1993-03-09, released 1994-12-20
The last revision prior to the SCOP 1.71 freeze date was dated 1995-01-15, with a file datestamp of 1995-01-19.
Experiment type: -
Resolution: 2.7 Å
R-factor: 0.192
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.71: d1was__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1was_ (-)
  mnqqgfvisnelrqqqseltstwdlmlqtrinlsrsaarmmmdasnqqssaktdllqnak
  ttlaqaaahyanfknmtplpamaeasanvdekyqryqaalaeliqfldngnmdayfaqpt
  qgmqnalgealgnyarvsenlyrqtf