PDB entry 1was

View 1was on RCSB PDB site
Description: the three-dimensional structure of the ligand-binding domain of a wild-type bacterial chemotaxis receptor
Class: chemotaxis
Keywords: chemotaxis
Deposited on 1993-03-09, released 1994-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.192
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bacterial aspartate receptor
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wasa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wasA (A:)
    mnqqgfvisnelrqqqseltstwdlmlqtrinlsrsaarmmmdasnqqssaktdllqnak
    ttlaqaaahyanfknmtplpamaeasanvdekyqryqaalaeliqfldngnmdayfaqpt
    qgmqnalgealgnyarvsenlyrqtf