PDB entry 1waq

View 1waq on RCSB PDB site
Description: crystal structure of human growth and differentiation factor 5 (gdf-5)
Class: growth factor
Keywords: growth factor, tgf-beta superfamily, cytokine
Deposited on 2004-10-27, released 2005-05-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.223
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth/differentiation factor 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WAQ
    • Uniprot P43026 (Start-116)
    Domains in SCOPe 2.08: d1waqa_
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1waqA (A:)
mkrqgkrpsknlkarcsrkalhvnfkdmgwddwiiapleyeafhceglcefplrshlept
nhaviqtlmnsmdpestpptccvptrlspisilfidsannvvykqyedmvvescgcr

    Sequence, based on observed residues (ATOM records): (download) 
    >1waqA (A:)
arcsrkalhvnfkdmgwddwiiapleyeafhceglcefplrshleptnhaviqtlmnsmd
pestpptccvptrlspisilfidsannvvykqyedmvvescgcr