PDB entry 1wao

View 1wao on RCSB PDB site
Description: pp5 structure
Class: hydrolase
Keywords: hydrolase, phosphatase, protein-protein interactions, tpr, super-helix, x-ray structure
Deposited on 2004-10-27, released 2005-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.247
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: serine/threonine protein phosphatase 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wao11, d1wao12
  • Chain '2':
    Compound: serine/threonine protein phosphatase 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wao21, d1wao22
  • Chain '3':
    Compound: serine/threonine protein phosphatase 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wao31, d1wao32
  • Chain '4':
    Compound: serine/threonine protein phosphatase 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wao41, d1wao42
  • Heterogens: MN

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1wao1 (1:)
    galkraeelktqandyfkakdyenaikfysqaielnpsnaiyygnrslaylrtecygyal
    gdatraieldkkyikgyyrraasnmalgkfraalrdyetvvkvkphdkdakmkyqecnki
    vkqkaferaiagdehkrsvvdsldiesmtiedeysgpkledgkvtisfmkelmqwykdqk
    klhrkcayqilvqvkevlsklstlvettlketekitvcgdthgqfydllnifelnglpse
    tnpyifngdfvdrgsfsveviltlfgfkllypdhfhllrgnhetdnmnqiygfegevkak
    ytaqmyelfsevfewlplaqcingkvlimhgglfsedgvtlddirkiernrqppdsgpmc
    dllwsdpqpqngrsiskrgvscqfgpdvtkafleennldyiirshevkaegyevahggrc
    vtvfsapnycdqmgnkasyihlqgsdlrpqfhqftavphpnvkpmayantllqlgmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wao1 (1:)
    galkraeelktqandyfkakdyenaikfysqaielnpsnaiyygnrslaylrtecygyal
    gdatraieldkkyikgyyrraasnmalgkfraalrdyetvvkvkphdkdakmkyqecnki
    vkqkaferakrsvvdsldiesmtiedeysgpkledgkvtisfmkelmqwykdqkklhrkc
    ayqilvqvkevlsklstlvettlketekitvcgdthgqfydllnifelnglpsetnpyif
    ngdfvdrgsfsveviltlfgfkllypdhfhllrgnhetdnmnqiygfegevkakytaqmy
    elfsevfewlplaqcingkvlimhgglfsedgvtlddirkiernrqppdsgpmcdllwsd
    pqpqngrsiskrgvscqfgpdvtkafleennldyiirshevkaegyevahggrcvtvfsa
    pnycdqmgnkasyihlqgsdlrpqfhqftavphpnvkpmayantllqlgmm
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >1wao2 (2:)
    galkraeelktqandyfkakdyenaikfysqaielnpsnaiyygnrslaylrtecygyal
    gdatraieldkkyikgyyrraasnmalgkfraalrdyetvvkvkphdkdakmkyqecnki
    vkqkaferaiagdehkrsvvdsldiesmtiedeysgpkledgkvtisfmkelmqwykdqk
    klhrkcayqilvqvkevlsklstlvettlketekitvcgdthgqfydllnifelnglpse
    tnpyifngdfvdrgsfsveviltlfgfkllypdhfhllrgnhetdnmnqiygfegevkak
    ytaqmyelfsevfewlplaqcingkvlimhgglfsedgvtlddirkiernrqppdsgpmc
    dllwsdpqpqngrsiskrgvscqfgpdvtkafleennldyiirshevkaegyevahggrc
    vtvfsapnycdqmgnkasyihlqgsdlrpqfhqftavphpnvkpmayantllqlgmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wao2 (2:)
    galkraeelktqandyfkakdyenaikfysqaielnpsnaiyygnrslaylrtecygyal
    gdatraieldkkyikgyyrraasnmalgkfraalrdyetvvkvkphdkdakmkyqecnki
    vkqkaferakrsvvdsldiesmtiedeysgpkledgkvtisfmkelmqwykdqkklhrkc
    ayqilvqvkevlsklstlvettlketekitvcgdthgqfydllnifelnglpsetnpyif
    ngdfvdrgsfsveviltlfgfkllypdhfhllrgnhetdnmnqiygfegevkakytaqmy
    elfsevfewlplaqcingkvlimhgglfsedgvtlddirkiernrqppdsgpmcdllwsd
    pqpqngrsiskrgvscqfgpdvtkafleennldyiirshevkaegyevahggrcvtvfsa
    pnycdqmgnkasyihlqgsdlrpqfhqftavphpnvkpmayantllqlg
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >1wao3 (3:)
    galkraeelktqandyfkakdyenaikfysqaielnpsnaiyygnrslaylrtecygyal
    gdatraieldkkyikgyyrraasnmalgkfraalrdyetvvkvkphdkdakmkyqecnki
    vkqkaferaiagdehkrsvvdsldiesmtiedeysgpkledgkvtisfmkelmqwykdqk
    klhrkcayqilvqvkevlsklstlvettlketekitvcgdthgqfydllnifelnglpse
    tnpyifngdfvdrgsfsveviltlfgfkllypdhfhllrgnhetdnmnqiygfegevkak
    ytaqmyelfsevfewlplaqcingkvlimhgglfsedgvtlddirkiernrqppdsgpmc
    dllwsdpqpqngrsiskrgvscqfgpdvtkafleennldyiirshevkaegyevahggrc
    vtvfsapnycdqmgnkasyihlqgsdlrpqfhqftavphpnvkpmayantllqlgmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wao3 (3:)
    galkraeelktqandyfkakdyenaikfysqaielnpsnaiyygnrslaylrtecygyal
    gdatraieldkkyikgyyrraasnmalgkfraalrdyetvvkvkphdkdakmkyqecnki
    vkqkaferakrsvvdsldiesmtiedeysgpkledgkvtisfmkelmqwykdqkklhrkc
    ayqilvqvkevlsklstlvettlketekitvcgdthgqfydllnifelnglpsetnpyif
    ngdfvdrgsfsveviltlfgfkllypdhfhllrgnhetdnmnqiygfegevkakytaqmy
    elfsevfewlplaqcingkvlimhgglfsedgvtlddirkiernrqppdsgpmcdllwsd
    pqpqngrsiskrgvscqfgpdvtkafleennldyiirshevkaegyevahggrcvtvfsa
    pnycdqmgnkasyihlqgsdlrpqfhqftavphpnvkpmayantllqlgmm
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >1wao4 (4:)
    galkraeelktqandyfkakdyenaikfysqaielnpsnaiyygnrslaylrtecygyal
    gdatraieldkkyikgyyrraasnmalgkfraalrdyetvvkvkphdkdakmkyqecnki
    vkqkaferaiagdehkrsvvdsldiesmtiedeysgpkledgkvtisfmkelmqwykdqk
    klhrkcayqilvqvkevlsklstlvettlketekitvcgdthgqfydllnifelnglpse
    tnpyifngdfvdrgsfsveviltlfgfkllypdhfhllrgnhetdnmnqiygfegevkak
    ytaqmyelfsevfewlplaqcingkvlimhgglfsedgvtlddirkiernrqppdsgpmc
    dllwsdpqpqngrsiskrgvscqfgpdvtkafleennldyiirshevkaegyevahggrc
    vtvfsapnycdqmgnkasyihlqgsdlrpqfhqftavphpnvkpmayantllqlgmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wao4 (4:)
    galkraeelktqandyfkakdyenaikfysqaielnpsnaiyygnrslaylrtecygyal
    gdatraieldkkyikgyyrraasnmalgkfraalrdyetvvkvkphdkdakmkyqecnki
    vkqkaferakrsvvdsldiesmtiedeysgpkledgkvtisfmkelmqwykdqkklhrkc
    ayqilvqvkevlsklstlvettlketekitvcgdthgqfydllnifelnglpsetnpyif
    ngdfvdrgsfsveviltlfgfkllypdhfhllrgnhetdnmnqiygfegevkakytaqmy
    elfsevfewlplaqcingkvlimhgglfsedgvtlddirkiernrqppdsgpmcdllwsd
    pqpqngrsiskrgvscqfgpdvtkafleennldyiirshevkaegyevahggrcvtvfsa
    pnycdqmgnkasyihlqgsdlrpqfhqftavphpnvkpmayantll