PDB entry 1wam

View 1wam on RCSB PDB site
Description: Structure of UDP-galactopyranose mutase from Klebsiella Pneumoniae with FADH-
Class: isomerase
Keywords: fad, flavoprotein, isomerase, lipopolysaccharide biosynthesis
Deposited on 2004-10-27, released 2006-05-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-galactopyranose mutase
    Species: Klebsiella pneumoniae [TaxId:573]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q48485
      • conflict (137)
      • conflict (261)
    Domains in SCOPe 2.07: d1wama1, d1wama2
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wamA (A:)
    mkskkilivgagfsgavigrqlaekghqvhiidqrdhiggnsydardsetnvmvhvygph
    ifhtdnetvwnyvnkhaemmpyvnrvkatvngqvfslpinlhtinqffsktcspdearal
    iaekgdstiadpqtfeeealrfigkelyeaffkgytikqwgmqpselpasilkrlpvrfn
    yddnyfnhkfqgmpkcgytqmiksilnhenikvdlqrefiveerthydhvfysgpldafy
    gyqygrlgyrtldfkkftyqgqyqgcavmnycsvdvpytritehkyfspweqhdgsvcyk
    eysraceendipyypirqmgemallekylslaenetnitfvgrlgtyryldmdvtiaeal
    ktaevylnsltenqpmpvftvsvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wamA (A:)
    skkilivgagfsgavigrqlaekghqvhiidqrdhiggnsydardsetnvmvhvygphif
    htdnetvwnyvnkhaemmpyvnrvkatvngqvfslpinlhtinqffsktcspdearalia
    ekgddpqtfeeealrfigkelyeaffkgytikqwgmqpselpasilkrlpvrfnyddnyf
    nhkfqgmpkcgytqmiksilnhenikvdlqrefiveerthydhvfysgpldafygyqygr
    lgyrtldfkkftyqgqyqgcavmnycsvdvpytritehkyfspweqhdgsvcykeysrac
    eendipyypirqmgemallekylslaenetnitfvgrlgtyryldmdvtiaealktaevy
    lnsltenqpmpvftvsv