PDB entry 1wal

View 1wal on RCSB PDB site
Description: 3-isopropylmalate dehydrogenase (ipmdh) mutant (m219a)from thermus thermophilus
Class: oxidoreductase
Keywords: oxidoreductase, leucine biosynthesis, nad-dependant enzyme
Deposited on 1999-05-17, released 1999-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.27 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (3-isopropylmalate dehydrogenase)
    Species: Thermus thermophilus [TaxId:274]
    Gene: LEUB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61495 (0-344)
      • engineered (218)
    Domains in SCOPe 2.07: d1wala_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1walA (A:)
    mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg
    veeaeavllgsvggpkwdglprkispetgllslrksqdlfanlrpakvfpglerlsplke
    eiargvdvlivreltggiyfgeprgmseaeawnteryskpevervarvafeaarkrrkhv
    vsvdkanvlevgefwrktveevgrgypdvalehqyvdaaamhlvrsparfdvvvtgnifg
    dilsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammleh
    afglvelarkvedavakalletpppdlggsagteaftatvlrhla