PDB entry 1wak

View 1wak on RCSB PDB site
Description: x-ray structure of srpk1
Deposited on 2004-10-26, released 2006-07-11
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.198
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase sprk1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1wakA (A:)
    peqeeeilgsdddeqedpndyckggyhlvkigdlfngryhvirklgwghfstvwlswdiq
    gkkfvamkvvksaehytetaldeirllksvrnsdpndpnremvvqllddfkisgvngthi
    cmvfevlghhllkwiiksnyqglplpcvkkiiqqvlqgldylhtkcriihtdikpenill
    svneqyirrlaaeatewqrsgapppsgsavstapatagnflvnplepknaeklkvkiadl
    gnacwvhkhftediqtrqyrslevligsgyntpadiwstacmafelatgdylfephsgee
    ytrdedhialiiellgkvprklivagkyskefftkkgdlkhitklkpwglfevlvekyew
    sqeeaagftdfllpmlelipekrataaeclrhpwlns
    

    Sequence, based on observed residues (ATOM records):
    >1wakA (A:)
    ckyhlvkigdlfngryhvirklgwghfstvwlswdiqgkkfvamkvvksaehytetalde
    irllksvrnsdpndpnremvvqllddfkisgvngthicmvfevlghhllkwiiksnyqgl
    plpcvkkiiqqvlqgldylhtkcriihtdikpenillsvneqyirrlaaeatagnflvnp
    lepknaeklkvkiadlgnacwvhkhftediqtrqyrslevligsgyntpadiwstacmaf
    elatgdylfephsgeeytrdedhialiiellgkvprklivagkyskefftkkgdlkhitk
    lkpwglfevlvekyewsqeeaagftdfllpmlelipekrataaeclrhpwlns