PDB entry 1waj

View 1waj on RCSB PDB site
Description: dna polymerase from bacteriophage rb69
Deposited on 1997-04-13, released 1998-01-14
The last revision prior to the SCOP 1.67 freeze date was dated 1998-01-14, with a file datestamp of 1998-01-14.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.21
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1waj_ (-)
    mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
    lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
    dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
    eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfdipyvynriknifgestak
    rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
    gklkydgpisklresnhqryisyniidvyrvlqidakrqfinlsldmgyyakiqiqsvfs
    piktwdaiifnslkeqnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsii
    rqvnispetiagtfkvaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfn
    qrkehkgymlaaqrngeiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslne
    mlfraqrtevagmtaqinrkllinslygalgnvwfryydlrnataittfgqmalqwierk
    vneylnevcgtegeafvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarerme
    paidrgfremceymnnkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtry
    aepklkimgletqksstpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisia
    svssanniakydvggfpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnp
    fgdkciawpsgteitdlikddvlhwmdytvllektfikplegftsaakldyekkaslfdm
    fdf