PDB entry 1wad

View 1wad on RCSB PDB site
Description: cytochrome c3 with 4 heme groups and one calcium ion
Class: electron transport
Keywords: electron transport, calcium binding
Deposited on 1996-01-10, released 1997-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.149
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c3
    Species: Desulfovibrio gigas [TaxId:879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wada_
  • Heterogens: CA, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wadA (A:)
    vdvpadgakidfiaggeknltvvfnhsthkdvkcddchhdpgdkqyagcttdgchnildk
    adksvnswykvvhdakggakptcischkdkagddkelkkkltgckgsachps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wadA (A:)
    vdvpadgakidfiaggeknltvvfnhsthkdvkcddchhdpgdkqyagcttdgchnildk
    adksvnswykvvhdakggakptcischkdkagddkelkkkltgckgsachp