PDB entry 1wab

View 1wab on RCSB PDB site
Description: platelet-activating factor acetylhydrolase
Class: platelet factor
Keywords: oxidoreductase, flavoprotein, fad, peroxisome, platelet factor
Deposited on 1996-10-30, released 1997-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.195
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: platelet-activating factor acetylhydrolase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1waba_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wabA (A:)
    msgdenpaskptpvqdvqgdgrwmslhhrfvadskdkepevvfigdslvqlmhqceiwre
    lfsplhalnfgiggdstqhvlwrlengelehirpkivvvwvgtnnhghtaeqvtggikai
    vqlvnerqpqarvvvlgllprgqhpnplreknrrvnelvraalaghprahfldadpgfvh
    sdgtishhdmydylhlsrlgytpvcralhslllrlltqdqgqggaplpepsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wabA (A:)
    enpaskptpvqdvqgdgrwmslhhrfvadskdkepevvfigdslvqlmhqceiwrelfsp
    lhalnfgiggdstqhvlwrlengelehirpkivvvwvgtnnhghtaeqvtggikaivqlv
    nerqpqarvvvlgllprgqhpnplreknrrvnelvraalaghprahfldadpgfvhsdgt
    ishhdmydylhlsrlgytpvcralhslllrll