PDB entry 1waa

View 1waa on RCSB PDB site
Description: IG27 protein domain
Class: metal binding protein
Keywords: metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, serine/threonine- protein kinase, structural protein.
Deposited on 2004-10-25, released 2006-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.211
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: titin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WAA (Start-3)
      • conflict (6)
      • conflict (81)
    • Uniprot Q8WZ42 (4-92)
    Domains in SCOPe 2.07: d1waaa_
  • Chain 'B':
    Compound: titin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WAA
      • conflict (6)
      • conflict (81)
    • Uniprot Q8WZ42 (4-92)
    Domains in SCOPe 2.07: d1waab_
  • Chain 'C':
    Compound: titin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WAA (0-3)
      • conflict (6)
      • conflict (81)
    • Uniprot Q8WZ42 (4-92)
    Domains in SCOPe 2.07: d1waac_
  • Chain 'D':
    Compound: titin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WAA (0-3)
      • conflict (6)
      • conflict (81)
    • Uniprot Q8WZ42 (4-92)
    Domains in SCOPe 2.07: d1waad_
  • Chain 'E':
    Compound: titin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WAA (0-3)
      • conflict (6)
      • conflict (55)
      • conflict (81)
    • Uniprot Q8WZ42 (4-End)
    Domains in SCOPe 2.07: d1waae_
  • Chain 'F':
    Compound: titin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WAA (0-3)
      • conflict (6)
      • conflict (80-81)
    • Uniprot Q8WZ42 (4-92)
    Domains in SCOPe 2.07: d1waaf_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1waaA (A:)
    gamalievekplygvevfvgetahfeielsepdvhgqwklkgqplaaspdceiiedgkkh
    ililhncqlgmtgevsfqaantksaanlkvkel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1waaA (A:)
    amalievekplygvevfvgetahfeielsepdvhgqwklkgqplaaspdceiiedgkkhi
    lilhncqlgmtgevsfqaantksaanlkvkel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1waaB (B:)
    gamalievekplygvevfvgetahfeielsepdvhgqwklkgqplaaspdceiiedgkkh
    ililhncqlgmtgevsfqaantksaanlkvkel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1waaB (B:)
    lievekplygvevfvgetahfeielsepdvhgqwklkgqplaaspdceiiedgkkhilil
    hncqlgmtgevsfqaantksaanlkvkel
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1waaC (C:)
    gamalievekplygvevfvgetahfeielsepdvhgqwklkgqplaaspdceiiedgkkh
    ililhncqlgmtgevsfqaantksaanlkvkel
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1waaD (D:)
    gamalievekplygvevfvgetahfeielsepdvhgqwklkgqplaaspdceiiedgkkh
    ililhncqlgmtgevsfqaantksaanlkvkel
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1waaE (E:)
    gamalievekplygvevfvgetahfeielsepdvhgqwklkgqplaaspdceiieegkkh
    ililhncqlgmtgevsfqaantksaanlkvkel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1waaE (E:)
    gamalievekplygvevfvgetahfeielsepdvhgqwklkgqplaaspdceiieegkkh
    ililhncqlgmtgevsfqaantksaanlkvke
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1waaF (F:)
    gamalievekplygvevfvgetahfeielsepdvhgqwklkgqplaaspdceiiedgkkh
    ililhncqlgmtgevsfqaaqtksaanlkvkel