PDB entry 1wa9

View 1wa9 on RCSB PDB site
Description: crystal structure of the pas repeat region of the drosophila clock protein period
Deposited on 2004-10-25, released 2005-01-12
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.2279
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: period circadian protein
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: period circadian protein
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1wa9A (A:)
    gervkedsfccvismhdgivlyttpsitdvlgyprdmwlgrsfidfvhlkdratfasqit
    tgipiaesrgsvpkdakstfcvmlrryrglksggfgvigrpvsyepfrlgltfreapeea
    rpdnymvsngtnmllvicatpikssykvpdeilsqkspkfairhtatgiishvdsaavsa
    lgylpqdligrsimdfyhhedlsvmketyetvmkkgqtagasfcskpyrfliqngcyvll
    etewtsfvnpwsrklefvvghhrvfqgpkqcnvfeaaptcklkiseeaqsrntrikediv
    krlaetvsrpsdtvkqevsrrcqalasfmetlmdevsradlklelpheneltvserdsvm
    lgeisphh
    

    Sequence, based on observed residues (ATOM records):
    >1wa9A (A:)
    edsfccvismhdgivlyttpsitdvlgyprdmwlgrsfidfvhlkdratfasqittgiak
    stfcvmlrryrglksggfgvigrpvsyepfrlgltfreapeearsngtnmllvicatpik
    ssykvpdeilsqkspkfairhtatgiishvdsaavsalgylpqdligrsimdfyhhedls
    vmketyetvmkkgqtagasfcskpyrfliqngcyvlletewtsfvnpwsrklefvvghhr
    vfqgpkqcnvfeaaptcklkiseeaqsrntrikedivkrlaetvsrpsdtvkqevsrrcq
    alasfmetlmdevsradl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1wa9B (B:)
    gervkedsfccvismhdgivlyttpsitdvlgyprdmwlgrsfidfvhlkdratfasqit
    tgipiaesrgsvpkdakstfcvmlrryrglksggfgvigrpvsyepfrlgltfreapeea
    rpdnymvsngtnmllvicatpikssykvpdeilsqkspkfairhtatgiishvdsaavsa
    lgylpqdligrsimdfyhhedlsvmketyetvmkkgqtagasfcskpyrfliqngcyvll
    etewtsfvnpwsrklefvvghhrvfqgpkqcnvfeaaptcklkiseeaqsrntrikediv
    krlaetvsrpsdtvkqevsrrcqalasfmetlmdevsradlklelpheneltvserdsvm
    lgeisphh
    

    Sequence, based on observed residues (ATOM records):
    >1wa9B (B:)
    vkedsfccvismhdgivlyttpsitdvlgyprdmwlgrsfidfvhlkdratfasqittgi
    pstfcvmlrryrglkpvsyepfrlgltfreapeearpdnymvsngtnmllvicatpikss
    ykvpdeilsqkspkfairhtatgiishvdsaavsalgylpqdligrsimdfyhhedlsvm
    ketyetvmkkgqtagasfcskpyrfliqngcyvlletewtsfvnpwsrklefvvghhrvf
    qgpkqcnvfeaaptcklkiseeaqsrntrikedivkrlaetvsrpsdtvkqevsrrcqal
    asfmetlmdevsradlkle