PDB entry 1wa8

View 1wa8 on RCSB PDB site
Description: Solution Structure of the CFP-10.ESAT-6 Complex. Major Virulence Determinants of Pathogenic Mycobacteria
Class: tuberculosis
Keywords: tuberculosis, cfp-10, esat-6, helix-turn-helix, four helix bundle, mycobacteria, pathogenesis, solution structure, psi, protein structure initiative, tb structural genomics consortium, tbsgc
Deposited on 2004-10-25, released 2005-06-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: esat-6 like protein esxb
    Species: MYCOBACTERIUM BOVIS [TaxId:1765]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wa8a1
  • Chain 'B':
    Compound: 6 kda early secretory antigenic target (esat-6)
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WA8 (0-0)
    • Uniprot Q57165 (1-94)
    Domains in SCOPe 2.08: d1wa8b1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wa8A (A:)
    aemktdaatlaqeagnferisgdlktqidqvestagslqgqwrgaagtaaqaavvrfqea
    ankqkqeldeistnirqagvqysradeeqqqalssqmgf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wa8B (B:)
    mteqqwnfagieaaasaiqgnvtsihslldegkqsltklaaawggsgseayqgvqqkwda
    tatelnnalqnlartiseagqamastegnvtgmfa