PDB entry 1wa7

View 1wa7 on RCSB PDB site
Description: sh3 domain of human lyn tyrosine kinase in complex with a herpesviral ligand
Class: sh3 domain
Keywords: sh3 domain, ligand, tyrosine kinase, signal transduction, lyn, tip, proto-oncogene, hypothetical protein
Deposited on 2004-10-25, released 2005-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein kinase lyn
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WA7
    • Uniprot P07948 (Start-64)
    Domains in SCOPe 2.07: d1wa7a_
  • Chain 'B':
    Compound: hypothetical 28.7 kda protein in dhfr 3'region (orf1)
    Species: SAIMIRIINE HERPESVIRUS 2 [TaxId:10381]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wa7A (A:)
    gspeeqgdivvalypydgihpddlsfkkgekmkvleehgewwkakslltkkegfipsnyv
    aklnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wa7A (A:)
    qgdivvalypydgihpddlsfkkgekmkvleehgewwkakslltkkegfipsnyvaklnt
    

  • Chain 'B':
    No sequence available.