PDB entry 1wa6

View 1wa6 on RCSB PDB site
Description: the structure of acc oxidase
Class: oxgenase
Keywords: 2og oxygenase, acco, acc oxidase
Deposited on 2004-10-25, released 2005-10-26
The last revision prior to the SCOP 1.73 freeze date was dated 2005-10-26, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.18885
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: 1-aminocyclopropane-1-carboxylate oxidase 1
    Species: Petunia hybrida
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1wa6x1
  • Heterogens: FE2, PO4, SO4, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1wa6X (X:)
    menfpiisldkvngveraatmemikdacenwgffelvnhgiprevmdtvekmtkghykkc
    meqrfkelvaskalegvqaevtdmdwestfflkhlpisnisevpdldeeyrevmrdfakr
    leklaeelldllcenlglekgylknafygskgpnfgtkvsnyppcpkpdlikglrahtda
    ggiillfqddkvsglqllkdgqwidvppmrhsivvnlgdqlevitngkyksvmhrviaqk
    dgarmslasfynpgsdaviypapalvekeaeenkqvypkfvfddymklyaglkfqakepr
    feamkametdvkmdpiatv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wa6X (X:)
    enfpiisldkvngveraatmemikdacenwgffelvnhgiprevmdtvekmtkghykkcm
    eqrfkelvaskalegvqaevtdmdwestfflkhlpisnisevpdldeeyrevmrdfakrl
    eklaeelldllcenlglekgylknafygskgpnfgtkvsnyppcpkpdlikglrahtdag
    giillfqddkvsglqllkdgqwidvppmrhsivvnlgdqlevitngkyksvmhrviaqkd
    garmslasfynpgsdaviypapalvqvypkfvfddymklyaglkfqakeprfeamkam