PDB entry 1wa5

View 1wa5 on RCSB PDB site
Description: crystal structure of the exportin cse1p complexed with its cargo (kap60p) and rangtp
Class: nuclear transport
Keywords: nuclear transport/complex, nuclear transport, exportin, importin alpha, ran gtpase, protein transport
Deposited on 2004-10-23, released 2004-12-13
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2344
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding nuclear protein ran
    Species: CANIS FAMILIARIS [TaxId:9615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1wa5a_
  • Chain 'B':
    Compound: importin alpha subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1wa5b_
  • Chain 'C':
    Compound: importin alpha re-exporter
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1wa5c_
  • Heterogens: GTP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wa5A (A:)
    maaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpik
    fnvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlc
    gnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wa5A (A:)
    pqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdt
    agqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdi
    kdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlef
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wa5B (B:)
    mdngtdsstskfvpeyrrtnfknkgrfsadelrrrrdtqqvelrkakrdealakrrnfip
    ptdgadsdeedessvsadqqfysqlqqelpqmtqqlnsddmqeqlsatvkfrqilsrehr
    ppidvviqagvvprlvefmrenqpemlqleaawaltniasgtsaqtkvvvdadavplfiq
    llytgsvevkeqaiwalgnvagdstdyrdyvlqcnamepilglfnsnkpslirtatwtls
    nlcrgkkpqpdwsvvsqalptlakliysmdtetlvdacwaisylsdgpqeaiqavidvri
    pkrlvellshestlvqtpalravgnivtgndlqtqvvinagvlpalrlllsspkenikke
    acwtisnitagnteqiqavidanlipplvkllevaeyktkkeacwaisnassgglqrpdi
    irylvsqgcikplcdlleiadnriievtldalenilkmgeadkearglninenadfieka
    ggmekifncqqnendkiyekaykiietyfgeeedavdetmapqnagntfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wa5B (B:)
    fvpeyrrtelrrrrdtqqvelrkakrdealakrrnfqelpqmtqqlnsddmqeqlsatvk
    frqilsrehrppidvviqagvvprlvefmrenqpemlqleaawaltniasgtsaqtkvvv
    dadavplfiqllytgsvevkeqaiwalgnvagdstdyrdyvlqcnamepilglfnsnkps
    lirtatwtlsnlcrgkkpqpdwsvvsqalptlakliysmdtetlvdacwaisylsdgpqe
    aiqavidvripkrlvellshestlvqtpalravgnivtgndlqtqvvinagvlpalrlll
    sspkenikkeacwtisnitagnteqiqavidanlipplvkllevaeyktkkeacwaisna
    ssgglqrpdiirylvsqgcikplcdlleiadnriievtldalenilkmgeadkearglni
    nenadfiekaggmekifncqqnendkiyekaykiietyfgeeed
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wa5C (C:)
    msdletvakflaesviastaktsernlrqletqdgfgltllhviastnlplstrlagalf
    fknfikrkwvdengnhllpannvelikkeivplmislpnnlqvqigeaissiadsdfpdr
    wptllsdlasrlsnddmvtnkgvltvahsifkrwrplfrsdelfleiklvldvftapfln
    llktvdeqitanennkaslnilfdvllvliklyydfncqdipeffedniqvgmgifhkyl
    sysnplledpdetehasvlikvkssiqelvqlyttryedvfgpminefiqitwnlltsis
    nqpkydilvskslsfltavtripkyfeifnnesamnniteqiilpnvtlreedvelfedd
    pieyirrdlegsdtdtrrractdflkelkeknevlvtniflahmkgfvdqymsdpsknwk
    fkdlyiylftalaingnitnagvsstnnllnvvdfftkeiapdltsnniphiilrvdaik
    yiytfrnqltkaqlielmpilatflqtdeyvvytyaaitiekiltiresntspafifhke
    disnsteillknlialilkhgsspeklaeneflmrsifrvlqtsedsiqplfpqllaqfi
    eivtimaknpsnprfthytfesigailnytqrqnlpllvdsmmptfltvfsediqefipy
    vfqiiafvveqsatipesikplaqpllapnvwelkgnipavtrllksfiktdssifpdlv
    pvlgifqrliaskayevhgfdllehimllidmnrlrpyikqiavlllqrlqnskteryvk
    kltvffglisnklgsdflihfidevqdglfqqiwgnfiittlptignlldrkialigvln
    mvingqffqskyptlisstmnsiietassqsianlkndyvdldnleeistfgshfsklvs
    isekpfdplpeidvnngvrlyvaealnkynaisgntflntilpqltqenqvklnqllvgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wa5C (C:)
    msdletvakflaesviastaktsernlrqletqdgfgltllhviastnlplstrlagalf
    fknfikrkwvdengnhllpannvelikkeivplmislpnnlqvqigeaissiadsdfpdr
    wptllsdlasrlsnddmvtnkgvltvahsifkrwrplfrsdelfleiklvldvftapfln
    llktvdeqitanekaslnilfdvllvliklyydfncqdipeffedniqvgmgifhkylsy
    snpllehasvlikvkssiqelvqlyttryedvfgpminefiqitwnlltsisnqpkydil
    vskslsfltavtripkyfeifnnesamnniteqiilpnvtlreedvelfeddpieyirrd
    legtrrractdflkelkeknevlvtniflahmkgfvdqymsnwkfkdlyiylftalaing
    nitnagvsstnnllnvvdfftkeiapdltsnniphiilrvdaikyiytfrnqltkaqlie
    lmpilatflqtdeyvvytyaaitiekiltiresntspafifhkedisnsteillknlial
    ilkhgsspeklaeneflmrsifrvlqtsedsiqplfpqllaqfieivtimaknpsnprft
    hytfesigailnytqrqnlpllvdsmmptfltvfsediqefipyvfqiiafvveqsatip
    esikplaqpllapnvwelkgnipavtrllksfiktdssifpdlvpvlgifqrliaskaye
    vhgfdllehimllidmnrlrpyikqiavlllqrlqnskteryvkkltvffglisnklgsd
    flihfidevqdglfqqiwgnfiittlptignlldrkialigvlnmvingqffqskyptli
    sstmnsiietassqsianlkndyveeistfgshfsklvsisekpfdplpeidvnngvrly
    vaealnkynaisgntflntilpqltqenqvklnqllvg