PDB entry 1wa4

View 1wa4 on RCSB PDB site
Description: crystal structure of the m131f l135a evad double mutant
Class: epimerase
Keywords: epimerase, evad, amycolatopsis orientalis, double mutant, orf24
Deposited on 2004-10-22, released 2007-01-30
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.18
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pcza361.16
    Species: AMYCOLATOPSIS ORIENTALIS [TaxId:31958]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O52806 (0-204)
      • mutation (130)
      • mutation (134)
    Domains in SCOPe 2.02: d1wa4a_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wa4A (A:)
    mqarklavdgaieftprvfaddrgllilpyqeeafveahggplfrvaqtihsmskrgvvr
    gihytvtppgtakyvycargkamdividirvgsptfgqwdsvlmdqqdpravylpvgvgh
    afvaleddtvfsymasrsyvtqdelalsaldpalglpidigvepivsdrdrvaitlaeaq
    rqgllpdyttsqeierrltavpvst