PDB entry 1wa4

View 1wa4 on RCSB PDB site
Description: Crystal structure of the M131F L135A EvaD double mutant
Class: epimerase
Keywords: epimerase, evad, amycolatopsis orientalis, double mutant, orf24
Deposited on 2004-10-22, released 2007-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pcza361.16
    Species: AMYCOLATOPSIS ORIENTALIS [TaxId:31958]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O52806 (0-204)
      • engineered mutation (130)
      • engineered mutation (134)
    Domains in SCOPe 2.07: d1wa4a_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wa4A (A:)
    mqarklavdgaieftprvfaddrgllilpyqeeafveahggplfrvaqtihsmskrgvvr
    gihytvtppgtakyvycargkamdividirvgsptfgqwdsvlmdqqdpravylpvgvgh
    afvaleddtvfsymasrsyvtqdelalsaldpalglpidigvepivsdrdrvaitlaeaq
    rqgllpdyttsqeierrltavpvst