PDB entry 1wa1

View 1wa1 on RCSB PDB site
Description: crystal structure of h313q mutant of alcaligenes xylosoxidans nitrite reductase
Class: reductase
Keywords: reductase, nitrite reductase, h313q mutant
Deposited on 2004-10-22, released 2005-01-04
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.165
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: dissimilatory copper-containing nitrite reductase
    Species: ALCALIGENES XYLOSOXIDANS [TaxId:85698]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O68601 (Start-335)
      • engineered mutation (312)
    Domains in SCOPe 2.02: d1wa1x1, d1wa1x2
  • Heterogens: CU, ZN, SO4, MES, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1wa1X (X:)
    qdadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfng
    smpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfka
    drsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytigefdlyip
    kgpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihs
    qanrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnh
    nlieafelgaagqikvegkwnddlmkqikapapipr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wa1X (X:)
    dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
    mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
    rsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytigefdlyipk
    gpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihsq
    anrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnhn
    lieafelgaagqikvegkwnddlmkqikapapipr