PDB entry 1w9z

View 1w9z on RCSB PDB site
Description: structure of bannavirus vp9
Deposited on 2004-10-21, released 2005-04-01
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.18646
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vp9
    Species: BANNA VIRUS [TaxId:77763]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: vp9
    Species: BANNA VIRUS [TaxId:77763]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: vp9
    Species: BANNA VIRUS [TaxId:77763]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1w9zA (A:)
    mlsetelralkklstttsrvvgdstlalpsnvklskgevekiavtkkemfdelaqcnlpt
    ielitrehtfngdvirfaawlflmngqklmiannvavrmgmqyatnlagnnvkityvtsn
    nvvklghiaagvlanpysnkgsglfityehnlisnqietgkvcvlfitslsttasstnsf
    aysacsvpiedwdfnmikltaetscasltamtnlvnslvpgertrpvglyvdipgvtvtt
    sassgslplttipavtplifsaytkqveevgvintlyalsylp
    

    Sequence, based on observed residues (ATOM records):
    >1w9zA (A:)
    alpsnvklskgevekiavtkkemfdelaqcnlptielitrehtfngdvirfaawlflmng
    qklmiannvavrmgmqyatnlagnnvkityvtsnnvvklghiaagvlanpysnkgsglfi
    tyehnlisnqietgkvcvlfitslsttasstnsfaysacsvpiedwdfnmikltaetsca
    sltamtnlvnslvpgertrpvglyvdipgvtvttsassgslplttipavtplifsaytkq
    veevgvintlyalsylp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1w9zB (B:)
    mlsetelralkklstttsrvvgdstlalpsnvklskgevekiavtkkemfdelaqcnlpt
    ielitrehtfngdvirfaawlflmngqklmiannvavrmgmqyatnlagnnvkityvtsn
    nvvklghiaagvlanpysnkgsglfityehnlisnqietgkvcvlfitslsttasstnsf
    aysacsvpiedwdfnmikltaetscasltamtnlvnslvpgertrpvglyvdipgvtvtt
    sassgslplttipavtplifsaytkqveevgvintlyalsylp
    

    Sequence, based on observed residues (ATOM records):
    >1w9zB (B:)
    alpsnvklskgevekiavtkkemfdelaqcnlptielitrehtfngdvirfaawlflmng
    qklmiannvavrmgmqyatnlagnnvkityvtsnnvvklghiaagvlanpysnkgsglfi
    tyehnlisnqietgkvcvlfitslsttasstnsfaysacsvpiedwdfnmikltaetsca
    sltamtnlvnslvpgertrpvglyvdipgvtvttsassgslplttipavtplifsaytkq
    veevgvintlyalsylp
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1w9zC (C:)
    mlsetelralkklstttsrvvgdstlalpsnvklskgevekiavtkkemfdelaqcnlpt
    ielitrehtfngdvirfaawlflmngqklmiannvavrmgmqyatnlagnnvkityvtsn
    nvvklghiaagvlanpysnkgsglfityehnlisnqietgkvcvlfitslsttasstnsf
    aysacsvpiedwdfnmikltaetscasltamtnlvnslvpgertrpvglyvdipgvtvtt
    sassgslplttipavtplifsaytkqveevgvintlyalsylp
    

    Sequence, based on observed residues (ATOM records):
    >1w9zC (C:)
    snvklskgevekiavtkkemfdelaqcnlptielitrehtfngdvirfaawlflmngqkl
    miannvavrmgmqyatnlagnnvkityvtsnnvvklghiaagvlanpysnkgsglfitye
    hnlisnqietgkvcvlfitslsttasstnsfaysacsvpiedwdfnmikltaetscaslt
    amtnlvnslvpgertrpvglyvdipgvtvttsassgslplttipavtplifsaytkqvee
    vgvintlyalsylp