PDB entry 1w9y

View 1w9y on RCSB PDB site
Description: the structure of acc oxidase
Class: oxygenase
Keywords: oxygenase, 2og oxygenase, acco, acc oxidase
Deposited on 2004-10-20, released 2005-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.2237
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1-aminocyclopropane-1-carboxylate oxidase 1
    Species: PETUNIA HYBRIDA [TaxId:4102]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1w9ya1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w9yA (A:)
    menfpiisldkvngveraatmemikdacenwgffelvnhgiprevmdtvekmtkghykkc
    meqrfkelvaskalegvqaevtdmdwestfflkhlpisnisevpdldeeyrevmrdfakr
    leklaeelldllcenlglekgylknafygskgpnfgtkvsnyppcpkpdlikglrahtda
    ggiillfqddkvsglqllkdgqwidvppmrhsivvnlgdqlevitngkyksvmhrviaqk
    dgarmslasfynpgsdaviypapalvekeaeenkqvypkfvfddymklyaglkfqakepr
    feamkametdvkmdpiatv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w9yA (A:)
    enfpiisldkvngveraatmemikdacenwgffelvnhgiprevmdtvekmtkghykkcm
    eqrfkelvaskalegvqaevtdmdwestfflkhlpisnisevpdldeeyrevmrdfakrl
    eklaeelldllcenlglekgylknafygskgpnfgtkvsnyppcpkpdlikglrahtdag
    giillfqddkvsglqllkdgqwidvppmrhsivvnlgdqlevitngkyksvmhrviaqkd
    garmslasfynpgsdaviypapalvqvypkfvfddymklyaglkfqakeprfeamkame