PDB entry 1w9x

View 1w9x on RCSB PDB site
Description: bacillus halmapalus alpha amylase
Class: hydrolase
Keywords: amylase, acarbose, bacillus, glycoside hydrolase
Deposited on 2004-10-20, released 2005-02-09
The last revision prior to the SCOP 1.73 freeze date was dated 2005-02-09, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.15223
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha amylase
    Species: BACILLUS HALMAPALUS
    Database cross-references and differences (RAF-indexed):
    • PDB 1W9X (0-480)
    Domains in SCOP 1.73: d1w9xa1, d1w9xa2
  • Heterogens: CA, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1w9xA (A:)
    tngtmmqyfewhlpndgqhwnrlrddasnlrnrgitaiwippawkgtsqndvgygaydly
    dlgefnqkgtvrtkygtrsqlesaihalknngvqvygdvvmnhkggadatenvlavevnp
    nnrnqeisgdytieawtkfdfpgrgntysdfkwrwyhfdgvdwdqsrqfqnriykfrgdg
    kawdwevdsengnydylmyadvdmdhpevvnelrrwgewytntlnldgfridavkhikys
    ftrdwlthvrnatgkemfavaefwkndlgalenylnktnwnhsvfdvplhynlynasnsg
    gnydmakllngtvvqkhpmhavtfvdnhdsqpgeslesfvqewfkplayaliltreqgyp
    svfygdyygipthsvpamkakidpilearqnfaygtqhdyfdhhniigwtregntthpns
    glatimsdgpggekwmyvgqnkagqvwhditgnkpgtvtinadgwanfsvnggsvsiwvk
    r