PDB entry 1w9w

View 1w9w on RCSB PDB site
Description: structure of a beta-1,3-glucan binding cbm6 from bacillus halodurans in complex with laminarihexaose
Class: carbohydrate-binding module
Keywords: carbohydrate-binding module, lectin, beta-glucan, carbohydrate binding, glycoside hydrolase
Deposited on 2004-10-19, released 2004-11-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.208
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bh0236 protein
    Species: Bacillus halodurans [TaxId:86665]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W9W
    • Uniprot Q9KG76 (6-End)
    Domains in SCOPe 2.07: d1w9wa_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w9wA (A:)
    gshmasdlknpyeriqaeaydamsgiqtegtdddgggdnigwindgdwvkyervhferda
    ssievrvasdtpggrieirtgsptgtllgdvqvpntggwqqwqtvtgnvqiqpgtydvyl
    vfkgspeydlmnvnwfvfrang
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w9wA (A:)
    dlknpyeriqaeaydamsgiqtegtdddgggdnigwindgdwvkyervhferdassievr
    vasdtpggrieirtgsptgtllgdvqvpntggwqqwqtvtgnvqiqpgtydvylvfkgsp
    eydlmnvnwfvfra