PDB entry 1w9w

View 1w9w on RCSB PDB site
Description: Structure of a beta-1,3-glucan binding CBM6 from Bacillus halodurans in complex with laminarihexaose
Class: carbohydrate-binding module
Keywords: carbohydrate-binding module, lectin, beta-glucan, carbohydrate binding, glycoside hydrolase
Deposited on 2004-10-19, released 2004-11-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bh0236 protein
    Species: Bacillus halodurans [TaxId:86665]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W9W
    • Uniprot Q9KG76 (6-End)
    Domains in SCOPe 2.08: d1w9wa_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1w9wA (A:)
gshmasdlknpyeriqaeaydamsgiqtegtdddgggdnigwindgdwvkyervhferda
ssievrvasdtpggrieirtgsptgtllgdvqvpntggwqqwqtvtgnvqiqpgtydvyl
vfkgspeydlmnvnwfvfrang

    Sequence, based on observed residues (ATOM records): (download) 
    >1w9wA (A:)
dlknpyeriqaeaydamsgiqtegtdddgggdnigwindgdwvkyervhferdassievr
vasdtpggrieirtgsptgtllgdvqvpntggwqqwqtvtgnvqiqpgtydvylvfkgsp
eydlmnvnwfvfra