PDB entry 1w9t

View 1w9t on RCSB PDB site
Description: Structure of a beta-1,3-glucan binding CBM6 from Bacillus halodurans in complex with xylobiose
Class: sugar binding protein
Keywords: sugar-binding protein, carbohydrate-binding module, lectin, beta-glucan, carbohydrate binding, glycoside hydrolase, sugar binding protein
Deposited on 2004-10-18, released 2004-11-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bh0236 protein
    Species: Bacillus halodurans [TaxId:86665]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W9T
    • Uniprot Q9KG76 (6-End)
    Domains in SCOPe 2.08: d1w9ta_
  • Chain 'B':
    Compound: bh0236 protein
    Species: Bacillus halodurans [TaxId:86665]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W9T
    • Uniprot Q9KG76 (6-End)
    Domains in SCOPe 2.08: d1w9tb_
  • Heterogens: NA, XYS, XYP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1w9tA (A:)
    gshmasdlknpyeriqaeaydamsgiqtegtdddgggdnigwindgdwvkyervhferda
    ssievrvasdtpggrieirtgsptgtllgdvqvpntggwqqwqtvtgnvqiqpgtydvyl
    vfkgspeydlmnvnwfvfrang
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w9tA (A:)
    dlknpyeriqaeaydamsgiqtegtdddgggdnigwindgdwvkyervhferdassievr
    vasdtpggrieirtgsptgtllgdvqvpntggwqqwqtvtgnvqiqpgtydvylvfkgsp
    eydlmnvnwfvfra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1w9tB (B:)
    gshmasdlknpyeriqaeaydamsgiqtegtdddgggdnigwindgdwvkyervhferda
    ssievrvasdtpggrieirtgsptgtllgdvqvpntggwqqwqtvtgnvqiqpgtydvyl
    vfkgspeydlmnvnwfvfrang
    

    Sequence, based on observed residues (ATOM records): (download)
    >1w9tB (B:)
    dlknpyeriqaeaydamsgiqtegtdddgggdnigwindgdwvkyervhferdassievr
    vasdtpggrieirtgsptgtllgdvqvpntggwqqwqtvtgnvqiqpgtydvylvfkgsp
    eydlmnvnwfvfra