PDB entry 1w9r

View 1w9r on RCSB PDB site
Description: solution structure of choline binding protein a, domain r2, the major adhesin of streptococcus pneumoniae
Deposited on 2004-10-15, released 2005-02-22
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: choline binding protein a
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Database cross-references and differences (RAF-indexed):
    • PDB 1W9R (0-3)
    • Uniprot Q97N74 (4-118)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1w9rA (A:)
    gshmpekkvaeaekkveeakkkaedqkeedrrnyptntyktleleiaesdvevkkaelel
    vkeeakeprneekvkqakaeveskkaeatrlekiktdrkkaeeeakrkaaeedkvkekp